Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G144600.1
Common NamePOPTR_0017s01400g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 685aa    MW: 75924.4 Da    PI: 6.8079
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G144600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++  +++t +q+ +Le++F+++++p++++r++L+++lgL+ +q+k+WFqNrR++ek
                        6778899***********************************************99 PP

               START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                         a  a++el+++  ++ep+W ks+       + + ++  + +            ++e +++s+ v+m+ ++lv  +ld + +W   ++    
                         6679*******************8777444444444433333...22678999**************************.99999988888 PP

               START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                         +a t+ v++ g      g lq m+ ++  lsplvp R+f+f+R + ql+ g+wvi+dvS d  ++   s++  +a +lpSg++i++++ng 
                         *************************************************************999965.555..566*************** PP

               START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         sk++wvehv+ ++r+  h l+r l+  ++a ga +w a lqr ce+
                         ***************99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.2652383IPR001356Homeobox domain
SMARTSM003895.7E-162587IPR001356Homeobox domain
CDDcd000861.01E-162684No hitNo description
PfamPF000467.7E-172681IPR001356Homeobox domain
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PROSITE profilePS5084836.904184418IPR002913START domain
SuperFamilySSF559617.83E-27185416No hitNo description
CDDcd088752.06E-99189414No hitNo description
SMARTSM002342.2E-27193415IPR002913START domain
PfamPF018521.1E-32196415IPR002913START domain
Gene3DG3DSA:3.30.530.202.1E-6288380IPR023393START-like domain
SuperFamilySSF559618.79E-13434647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2755411e-144GU275541.1 Populus balsamifera isolate POR11 haplotype B unknown gene, partial sequence.
GenBankGU2755421e-144GU275542.1 Populus balsamifera isolate GIL14 haplotype A unknown gene, partial sequence.
GenBankGU2755431e-144GU275543.1 Populus balsamifera isolate GIL14 haplotype B unknown gene, partial sequence.
GenBankGU2755441e-144GU275544.1 Populus balsamifera isolate KUU07 haplotype A unknown gene, partial sequence.
GenBankGU2755451e-144GU275545.1 Populus balsamifera isolate KUU07 haplotype B unknown gene, partial sequence.
GenBankGU2755461e-144GU275546.1 Populus balsamifera isolate MGR10 haplotype A unknown gene, partial sequence.
GenBankGU2755471e-144GU275547.1 Populus balsamifera isolate MGR10 haplotype B unknown gene, partial sequence.
GenBankGU2755481e-144GU275548.1 Populus balsamifera isolate STO11 haplotype A unknown gene, partial sequence.
GenBankGU2755491e-144GU275549.1 Populus balsamifera isolate STO11 haplotype B unknown gene, partial sequence.
GenBankGU2755501e-144GU275550.1 Populus balsamifera isolate WHR03 haplotype A unknown gene, partial sequence.
GenBankGU2755521e-144GU275552.1 Populus balsamifera isolate FRE01 haplotype A unknown gene, partial sequence.
GenBankGU2755541e-144GU275554.1 Populus balsamifera isolate GAL12 haplotype A unknown gene, partial sequence.
GenBankGU2755561e-144GU275556.1 Populus balsamifera isolate HAY07 haplotype A unknown gene, partial sequence.
GenBankGU2755571e-144GU275557.1 Populus balsamifera isolate HAY07 haplotype B unknown gene, partial sequence.
GenBankGU2755581e-144GU275558.1 Populus balsamifera isolate LOV02 haplotype A unknown gene, partial sequence.
GenBankGU2755591e-144GU275559.1 Populus balsamifera isolate LOV02 haplotype B unknown gene, partial sequence.
GenBankGU2755601e-144GU275560.1 Populus balsamifera isolate RNA13 haplotype A unknown gene, partial sequence.
GenBankGU2755611e-144GU275561.1 Populus balsamifera isolate RNA13 haplotype B unknown gene, partial sequence.
GenBankGU2755621e-144GU275562.1 Populus balsamifera isolate STL13 haplotype A unknown gene, partial sequence.
GenBankGU2755631e-144GU275563.1 Populus balsamifera isolate STL13 haplotype B unknown gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323744.20.0hypothetical protein POPTR_0017s01400g
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLB9IJC20.0B9IJC2_POPTR; Uncharacterized protein
STRINGPOPTR_0017s01400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11